PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.307210.1
Common NameCsa_3G736780, LOC101212699
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 174aa    MW: 18763.9 Da    PI: 6.5184
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.307210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.12.6e-5824120197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+kyre+eg
  Cucsa.307210.1  24 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKTYLTKYRETEG 118
                     69********************************************************************************************* PP

           NF-YB  96 ek 97 
                     ++
  Cucsa.307210.1 119 DT 120
                     97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.7E-5619136IPR009072Histone-fold
SuperFamilySSF471135.69E-4127135IPR009072Histone-fold
PfamPF008082.0E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.0E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.0E-217795No hitNo description
PRINTSPR006153.0E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MADAPASPGG GSHESGEQSP RSNVREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKTYL TKYRETEGDT  120
KGSAKGGDGS AKKEAHPTPI PQMAHQGSFS QGVNYASSQS QAQHLMVPMQ GTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-4823115193NF-YB
4awl_B1e-4723115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4723115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B9e-4824115192Transcription factor HapC (Eurofung)
4g92_B9e-4824115192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG0038750.0HG003875.1 Cucumis sativus mRNA for nuclear transcription factor Y subunit B-8-like, cultivar Summer Green.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137802.11e-128PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1
RefseqXP_008442637.11e-128PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1
SwissprotQ8VYK49e-87NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0A0LAB91e-128A0A0A0LAB9_CUCSA; Uncharacterized protein
STRINGGLYMA03G33490.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.37e-76nuclear factor Y, subunit B8
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]